PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.F00039.1.p
Common NameEUGRSUZ_F00039, LOC104447770
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family Dof
Protein Properties Length: 256aa    MW: 25484.1 Da    PI: 8.3828
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.F00039.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof124.72.9e-392887362
            zf-Dof  3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62
                      ++al+cprCdstntkfCy+nny+lsqPr+fCk+CrryWt+GG+lrnvPvGgg+rk  +ss
  Eucgr.F00039.1.p 28 TEALPCPRCDSTNTKFCYFNNYNLSQPRHFCKSCRRYWTQGGTLRNVPVGGGSRKASSSS 87
                      6889***************************************************98876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074782.0E-212676IPR003851Zinc finger, Dof-type
PfamPF027011.0E-333085IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.2173185IPR003851Zinc finger, Dof-type
PROSITE patternPS0136103369IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 256 aa     Download sequence    Send to blast
MPSDARPQAS AAAAAGGAGL HPHPPPQTEA LPCPRCDSTN TKFCYFNNYN LSQPRHFCKS  60
CRRYWTQGGT LRNVPVGGGS RKASSSSSSK RPRSLAPPTS SSPCSNSNSS SVSQEPLHGD  120
HSGLLLAQVK SEVGSGDQVK RTENVAGPGV GSGHQGFTSL LGSPGGQGFL ALGGLGLGTG  180
LDGLGFGFGR GVWPFNEVGF VDGGGVYGGG GGGGPVAAAG GNAWQMGSGE GGGLVDGDGF  240
AWPELAISMP GQGLK*
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.F00039.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3541491e-54AK354149.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv1005F20.
GenBankAK3609341e-54AK360934.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv1128K17.
GenBankAK3770581e-54AK377058.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv3146P05.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010059780.10.0PREDICTED: dof zinc finger protein DOF1.6-like
TrEMBLA0A059BKI40.0A0A059BKI4_EUCGR; Uncharacterized protein
STRINGGLYMA02G06970.25e-68(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM22862874
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66940.16e-28Dof family protein